PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy015001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 451aa    MW: 50629.3 Da    PI: 6.201
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59539344PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.46.6e-142264481374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lLl+cA++v++g+le+a+ +L ++s+laspdgd+mqR+aayf eALa r+++++++l +al++++     +see+ ++klf e++P+lk+s++++Nq
  Ahy015001  26 LIHLLLTCANHVAAGSLENANVMLDQISQLASPDGDTMQRIAAYFNEALADRILKTWPGLHRALNSTRIV--MVSEEILVQKLFLELFPFLKVSYILTNQ 123
                689*************************************************************988886..69************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                aI+ea+ege++vHiiD+++ +++QW+aLlq +++Rpegpp+lRiTgv++    +ke le+++++L++ Ae+l++pf+f++ v+++le+l++++Lrvk+gE
  Ahy015001 124 AIVEAMEGEKMVHIIDLNAAEPAQWIALLQVFSARPEGPPHLRITGVHH----QKEILEQMAHKLTEEAEKLDIPFQFHP-VVSKLENLDFDKLRVKTGE 218
                *************************************************....9**************************.799**************** PP

       GRAS 201 alaVnlvlqlhrll........................................................desvsles..erdevLklvkslsPkvvvvv 242
                ala++++lqlh+ll                                                           vsl+   + +++L+++++lsPkv++v+
  Ahy015001 219 ALAISSILQLHSLLglddealrrrspllsknsngihlqkallmnqstlgdllekdtlngyspspdsasssP--VSLTAsmTAESFLNALWGLSPKVMIVT 316
                ******************************************************************99652..44433336688**************** PP

       GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                eq+++hn+++++er+leal+ y+alfd+le++++r+s er kvE++l+g+ei+n++acegaerrerhe+l kW +rl+ +GF++vpls++ + qa++ l+
  Ahy015001 317 EQDSNHNGSTLMERVLEALYSYAALFDCLESTVSRTSVERLKVEKMLFGEEIKNIIACEGAERRERHEKLDKWIQRLDLSGFGNVPLSYYGMLQARRFLQ 416
                **************************************************************************************************** PP

       GRAS 343 kvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 ++ +gy++ +e+g++v++W+drpL+s+SaWr
  Ahy015001 417 SCGCEGYKMRDENGCVVICWQDRPLFSISAWR 448
                *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.961428IPR005202Transcription factor GRAS
PfamPF035142.3E-13926448IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MSLSPSIGSP YTWLRELKSE ERGLALIHLL LTCANHVAAG SLENANVMLD QISQLASPDG  60
DTMQRIAAYF NEALADRILK TWPGLHRALN STRIVMVSEE ILVQKLFLEL FPFLKVSYIL  120
TNQAIVEAME GEKMVHIIDL NAAEPAQWIA LLQVFSARPE GPPHLRITGV HHQKEILEQM  180
AHKLTEEAEK LDIPFQFHPV VSKLENLDFD KLRVKTGEAL AISSILQLHS LLGLDDEALR  240
RRSPLLSKNS NGIHLQKALL MNQSTLGDLL EKDTLNGYSP SPDSASSSPV SLTASMTAES  300
FLNALWGLSP KVMIVTEQDS NHNGSTLMER VLEALYSYAA LFDCLESTVS RTSVERLKVE  360
KMLFGEEIKN IIACEGAERR ERHEKLDKWI QRLDLSGFGN VPLSYYGMLQ ARRFLQSCGC  420
EGYKMRDENG CVVICWQDRP LFSISAWRSR K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-40264484375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016202188.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLV7ADC70.0V7ADC7_PHAVU; Uncharacterized protein
STRINGGLYMA11G10170.30.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3